PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma21g00680.1
Common NameZOSMA_21G00680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 238aa    MW: 27343.1 Da    PI: 9.7535
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma21g00680.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF953.3e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++nrqvtf+kRrng+ KKA+ELSvLCdaeva+iifs++g+lyey+s
  Zosma21g00680.1  9 KRIENTTNRQVTFCKRRNGLQKKAYELSVLCDAEVALIIFSTRGRLYEYAS 59
                     79***********************************************86 PP

2K-box56.21.5e-19771815100
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLes.......L..slkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                      sg sl +a+a+++++e +kL+++ +++q+++R +lGe+ ++       L   +k+L+  e qLek+++kiR k+ e+l+++ie++qk+e elq+
  Zosma21g00680.1  77 SGGSLIDANAQEYRKETSKLQQKSSMIQNSIREYLGESFTNsfvptkdLkeHIKDLKIKEGQLEKAIQKIRLKRAEVLHAEIEYMQKRELELQK 170
                      55668899******************************97522222224335899*************************************** PP

            K-box  90 enkaLrkklee 100
                      +n +Lr++++e
  Zosma21g00680.1 171 DNIYLRSQIAE 181
                      ********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.7E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.655161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-33276IPR002100Transcription factor, MADS-box
CDDcd002656.95E-42273No hitNo description
PRINTSPR004043.9E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.9E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-323859IPR002100Transcription factor, MADS-box
PfamPF014862.4E-1285179IPR002487Transcription factor, K-box
PROSITE profilePS5129710.84986185IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLQK KAYELSVLCD AEVALIIFST RGRLYEYASS  60
SVKSTTDRYK KVSMGNSGGS LIDANAQEYR KETSKLQQKS SMIQNSIREY LGESFTNSFV  120
PTKDLKEHIK DLKIKEGQLE KAIQKIRLKR AEVLHAEIEY MQKRELELQK DNIYLRSQIA  180
ENEQSAEHHN MNLNMSMSMN MNMGISSSYD GRSFMHVNLM DPNYSQYSQQ QTALQLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-21173173Myocyte-specific enhancer factor 2B
1tqe_R2e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q2e-21173173Myocyte-specific enhancer factor 2B
1tqe_P2e-21173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272685.16e-88PREDICTED: floral homeotic protein AGAMOUS-like
SwissprotQ407042e-82MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0K9PJT21e-176A0A0K9PJT2_Z
STRINGGSMUA_Achr10P14160_0012e-80(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.15e-74MIKC_MADS family protein